SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000390913 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000390913
Domain Number 1 Region: 186-269
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-20
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000390913
Sequence length 308
Comment PABPN1L (Homo_sapiens) poly(A) binding protein, nuclear 1-like (cytoplasmic)
Sequence
MWPFQSCTLFPPPTEAWLQTVSSDPEAQGWGAWARSEKTPLEPGSGGGREAEEEEDGDAG
FPLSLLESDSLANGPEPDQVLQDVPRLTLPCWQGLEAIKLKLWTMEQAQGAPEPPSKQEL
ATEEEGARARQLLSPETVGGPFPVAPRETVEADHRSIYVGNSECYCTGSWAPSPLCAENT
GAVPGQVDYGGTAEELQAHFHPCGEVHRVTILCDKFSGHPKGYAYVEFTTQLSAQAAVEL
DESIFRGRVIKVLPKRTNFPGISSTDRGGLQGTRVVAAPCSSLQGRPRFRPRGQGRGRGR
FSMWFSPY
Download sequence
Identical sequences G5C2T5
HGL_H00000390913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]