SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000391126-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000391126-2
Domain Number 1 Region: 73-305
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.13e-58
Family Ankyrin repeat 0.00000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000391126-2
Sequence length 525
Comment PPP1R16A (Homo_sapiens) protein phosphatase 1, regulatory (inhibitor) subunit 16A
Sequence
MAEHLELLAEMPMVGRMSTQDRLKHAQKRRAQQVKQWAQAEKEAQGKKVHGERPQKEGAG
QGPRKKVLFPPSIALLEAAARNDLEEVCQFLRNGVSPDLANEDGLTALHQCCIDDFQEMA
QQLLEAGADVNAQDSECWTPLHAAATCGHLHLVELLISRGADLLAVNTDGNMPYDLCEDE
QTLDCLETAMASQGITQGSIEEARAVPELRMVDDLQSLLRAGADLNDPLDHGATLLHIAA
ANGFSEAAALLLEHGASLSAKDQDGWEPLHAAAYWGQVHLAELLVAHGANLNGKSLMDET
PLDVCGDEEVRAKLLELKHKHDALLRGQGRQRSLLRRRTSSAGSRGKVVRRVSLTQRTNL
YRKEHAQEAIVWRQPPPTSPEPLEDDEDRQTDAALQLPPPEEDDPDVARSHNGQVEGPPG
RHLYSKRLDRSVSYQLSPLDSMASNNLVRDKAHQTLADLKRQRAAAKLLRLSPEGSEAPE
PSLPTDTETSHPGCGSRAGRDPPMLKLTAPSEEAHMEKRPCCLLM
Download sequence
Identical sequences G5C5R9
XP_004837750.1.39548 XP_012924540.1.39548 XP_012924544.1.39548 XP_012924549.1.39548 HGL_H00000391126-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]