SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000391432 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000391432
Domain Number 1 Region: 390-510
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-18
Family Canonical RBD 0.0006
Further Details:      
 
Domain Number 2 Region: 10-105
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000981
Family Canonical RBD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000391432
Sequence length 517
Comment RNPC3 (Homo_sapiens) RNA-binding region (RNP1, RRM) containing 3
Sequence
MAAPEQPLPLSRRCPSSTSLSPPRGDRTLLVRHLPAELSPEEKEDLLKYFGAQSVRVLSD
KGRLKHTAFATFPNEKAAIKALTRLHQLKLLGHTLVVEFAKEQDQVHSPCPTSGTEKKKR
SDDTIEDDKEKKEFGCLTVENGIAPNHGLTFPLNSCLKYMYPPPSSTILANIVNALASVP
KFYVQVLHLMNKMNLPTPFGPITARPPMYEDYVPLHAPLPPTSPRPPEEPPLPDEDEELS
SKESEYESSDEEDRQRMSKLMELANLQPKRPKITKQRHVRKKQKIKDMLNLSSSASHSNL
HPVLLPSDVFDQPQPVGSKRIEFHISTDMPNVFKKDLQKEQNCEEKCYDLPAIEVEASNI
GFGKIFPKPNTNITEESKEDSDEMPSECISRRELEKGRISREEMESLSVFRSYEPGEPNC
RIYVKNLAKHVQEKDLKFIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAA
KALKEANGYILFGKPMVVQFARSARPKQDSKEGKRKC
Download sequence
Identical sequences G5AZM5
XP_004869213.1.39548 HGL_H00000391432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]