SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000391669 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000391669
Domain Number 1 Region: 80-162
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000391669
Sequence length 932
Comment BCAR1 (Homo_sapiens) breast cancer anti-estrogen resistance 1
Sequence
MTSPSTNLCLALCQLVRERLAQGKVTTPLALQGHGFFLSLGLAALTSGLRKSFPASASRA
THQWASSPPSCAVCQPRPQENVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWW
LCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATVAQPQPQPSLPPGLHATVPPASQ
YTPMLPAAYQPQPDSVYLVPTPSKAQQGLYQAPGSSPQFQSPPAKQTSTFSKQTPHHPFP
SPATDLYQVPPGPGNPAQDIYQVPPSAGIGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRV
GQGYVYEASQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPN
GRDPLLDVYDVPPSVEKGLPPSGHHVVYDVPPSVSKDVPDGPVQREETYDVPPAFAKVKP
FDPARHPLILAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGSLYDVPRERVLPPE
VADGVVDDGVYAVPPPAEPEAMPVADGKPVSGREPLELEVAVESLARLQQGVSATVAHLL
DLVGSASGAGGWRGTPEPQEPPVQDLQASVTAVQSAVHELLEFARSAVGNAAHTSDRTLH
AKLGRQLQKMEDVYQTLVAHGQVLDNGRGGPGFTLEDLDRLVACSRAVPEDAKQLASFLH
GNASLLFRRTKAPAPGPEGGGPLHPNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEG
GWMEDYDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHD
LANWTPAQPLAPGRPGALGPSDRQLLLFYLEQCEANLTILTDAVDAFFTAVATNQPPKIF
VAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYP
SPSAAQDMVDRVKELGHSTQQFRRVLGQLAAA
Download sequence
Identical sequences G5B5X8
HGL_H00000391669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]