SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000391684-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000391684-2
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000391684-2
Sequence length 57
Comment RPL39 (Homo_sapiens) ribosomal protein L39
Sequence
IGCISLQSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences G5BU72
HGL_H00000391684-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]