SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000392709 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000392709
Domain Number 1 Region: 243-660
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.42e-94
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00042
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.51e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000392709
Sequence length 727
Comment NDUFS1 (Homo_sapiens) NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
Sequence
MLRIPVRRALAGLSKSSTGYVRTTATVASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTTGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLQVALIGSPVDLTYRYDHLGESPKVLQDIASGSHPFSQVLKAAKKPMVVLGSSA
LQRSDGAAILTAVSSIAQNIRVTSGVPSDWKVMNILHRVASQVAALDLGYKPGVEAVRKN
PPRVLFLLGADGGCITRHDLPKDCFIIYQGHHGDVGALIADVILPGAAYTEKSGTYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITVPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
Download sequence
Identical sequences G5C5M0
HGL_H00000392709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]