SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393248-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393248-1
Domain Number 1 Region: 9-96
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9e-31
Family Canonical RBD 0.0000147
Further Details:      
 
Weak hits

Sequence:  HGL_H00000393248-1
Domain Number - Region: 147-172
Classification Level Classification E-value
Superfamily N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0379
Family N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393248-1
Sequence length 180
Comment PABPC1L2A (Homo_sapiens) poly(A) binding protein, cytoplasmic 1-like 2A
Sequence
MVGLTVRDPAVDHSLCSVFVGNIPHEASEEQLRDIFSEVGPVVSFRWVYDRETGKPKGYG
FCEYQDQETALSAMQHLNGHEFSGRALRVDSAASEKNKELKCLGTGMTASAVAALILMTS
SIVSVVGSLYLAYILYFVLKEFCIICVATYVLNFILLIINYKRLVYLNEAWKRQLQPKQD
Download sequence
Identical sequences G5ASS7
HGL_H00000393248-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]