SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393260-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393260-1
Domain Number 1 Region: 582-643
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 175-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 811-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 1066-1122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 867-923
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 1107-1159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 213-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 775-824
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000475
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393260-1
Sequence length 1229
Comment ZNF7 (Homo_sapiens) zinc finger protein 7
Sequence
MHISSVTPWFLHSWLAAAIFTSQTEGNTASGHLAARGPVSPDYPVSRTRFLLLHLFPHEG
DLGSPDSPDPPVCPEGSPGVVCASLDGGASRRSRLNALAFTLQPPLTTPPRVQGLPPRPP
AGNAVPAQPGPRDSGVTDRMELEPATETFVLELRCLADGGPGPDTLSGEGWGGMHSNLVT
HQRIHTGEKPYACSYCSKRFSESSALVQHQRTHTGERPYACGDCGKRFSVSSNLLRHRRT
HSGERPYVCEDCGERFRHKVQIRRHERQLHACHVLHMCWLSGSCLPGTMAALQTTLDSPA
PQLERVEDGSECDPDQEEEEEKGKDVEEVEEEEEEEEEAEDTAEVVEVAEVEVEAEFDGD
DDSDGDDDDDDNDDEEDGVEEVLAEEQSPGLGAQEQLSHGGDARSPALGRALQMCQVPVA
TQDEDLEEEEEEEEEEEDFLTAGSQCPHSVGTICPPWSSPSGCCGGHSICLGQTEVGGVV
GLGFIVSCPLCESCLCLYPLKAGSSPSLGLRSWSLDGTGAPPPGIGERTKVLCSVDNEGL
ACVPLGSTLQGLSVVSLTALHGCVYTQPLTQGSRGQCLGPCAFQGLVTFEDVAVYFSLEE
WERLDVNQRALYQEVMQENYGILVSLGYPVPKPELIFRLEQGEEPWVPDSPHPEEGDIVT
GVYTGAWYWTDDMEDHEEEDDEDFLAEMAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSA
QTPEGWGSDSGNLGVLAEESEAKPFLPGQEPDSNLMAPWPYPTEEAAPTGRPETTCDVCG
KVFPHRSRLGKHQRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFV
YKSHLVTHRRIHTGERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCAHCGRSFSQSSA
LARHQAVHTADRPHCCPDCGQAFRLRADFQRHRRSGGCAEPGSEGPRREPCEAATAMGLK
EPETALEGPEEPQQSVSADRDPEAEAREEAAAAEARPESKQDPEPSRRFLGMDNGLGEGE
GPSSHPLGFHFPMHPQSWLHPDGFPILGLTDIGDRVPADGHCGKGFGHSSDFKRHRRTHT
GEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRSVLVTHQRTHTGERP
YACAHCGRRFSQSSHLLTHMKTHRGAVGAPGQAGATVTPMPKAEAPARGQLSAGSAPREC
GSTLLEFAGGTSFGSEAAFAGPSAAYEES
Download sequence
Identical sequences G5BF47
HGL_H00000393260-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]