SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393313 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393313
Domain Number 1 Region: 507-606
Classification Level Classification E-value
Superfamily EF-hand 1.51e-24
Family Eps15 homology domain (EH domain) 0.0000666
Further Details:      
 
Domain Number 2 Region: 254-296,402-456
Classification Level Classification E-value
Superfamily EF-hand 6.04e-18
Family Eps15 homology domain (EH domain) 0.00019
Further Details:      
 
Domain Number 3 Region: 91-145
Classification Level Classification E-value
Superfamily EF-hand 0.00000000147
Family Eps15 homology domain (EH domain) 0.00093
Further Details:      
 
Domain Number 4 Region: 626-811
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000719
Family Tropomyosin 0.0024
Further Details:      
 
Domain Number 5 Region: 163-235
Classification Level Classification E-value
Superfamily EF-hand 0.0000112
Family Eps15 homology domain (EH domain) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393313
Sequence length 1158
Comment EPS15L1 (Homo_sapiens) epidermal growth factor receptor pathway substrate 15-like 1
Sequence
MAMLPRLHLVLVPLPTSILCQPMCWCLAEPAGIRELTLGPLQPSCGLHPSSVAGGSSGGS
VCCIPCLGQGPSVELWHQRLYRPHQIPGGNPLYESYYKQVDPAYTGRVGASEAALFLKKS
GLSDVTLGKIWDLADPEGKGFLDKQHDTSSPLMVTLPSAEAPWAVRVEEKAKFDGIFESL
LPVKGLLSGDKVKPVLMNSKLPLDVLGRGFYVALRLVACAQSGHEVTLSNLNLSMPPPKF
HDTSSPLMVTLPSAEAPWAVRVEEKAKFDGIFESLLPVKGLLSGDKVKPVLMNSKLPLDV
LGRGRQGRMKAGGARASALASVETLACLHDTGQCDRLAGQLEAESVHGSSWLRGEGWQRR
GATAPPGGGHSSQCPQLTLAASRVVLGNSQSPKDTVAPAALPATHEGLVWDLSDIDKDGH
LDRDEFAVAMHLVYRALEKEPVPSILPLSLIPLSKRKKPVFPGAVPVLPGSPPPKDSLRS
TPSHGRVSSLNSTGSLSPKHSLKQAQPAVAWVVPVADKMRFDEIFLKTDLDLDGYVSGQE
VKEIFMHSGLTQSLLAHIWALADTRQMGKLSKDQFALAMHLIQQKVTKGVDPPQALSPDM
VPPSERGTPVLDSASSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKT
SEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMIS
SLKTQIQSQESDLKSQEDDLNRAKSELSRLQQEETQLEQSIQAGRAQLETILKSLQSTED
EISQTRSKLSQLHESRLDARRSLEQYEKALDGAGLADLAALSEGVALAERGGFGAMDDPF
KNKALLFSNNTQDLHPDPFQAEDPFKSDPFKGADPFKGDPFQSDPFAEQPAAAPDPFGGD
PFKESDPFRGSAPDDFFKKQTKSDPFTSDPFTKTSSLPSKLDPFESSDPFSSSVSSRGSD
PFGTLDPFGSWAFSSAEGFADFSQMSKPLPSGPFASSLAGAGPSEDPFKSKPDTPTLPPK
KPAPPRPKPPSEAVAGRDSPVLYTLLGAKPSQASSSGFADFASPLGADSGDPFQNKKGFG
DPFSGKDPFVPSSSAKPSQASSSGFADFASFGNEEQQLAWAKRESEKAEQERLARLRRQE
QEDLELAIALSKADMPAV
Download sequence
Identical sequences G5C2V7
HGL_H00000393313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]