SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393348 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393348
Domain Number 1 Region: 156-231
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-21
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000163
Family LASP-1 0.0028
Further Details:      
 
Weak hits

Sequence:  HGL_H00000393348
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0002
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393348
Sequence length 232
Comment LASP1 (Homo_sapiens) LIM and SH3 protein 1
Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPGGAGEGLEPDRRDTQDSSSYRRPPEQQPQPHHTPTSTPGGCGKRYRA
VYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences G5BK68
HGL_H00000393348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]