SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000393518 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000393518
Domain Number 1 Region: 145-374
Classification Level Classification E-value
Superfamily Macro domain-like 7.74e-51
Family Macro domain 0.00014
Further Details:      
 
Domain Number 2 Region: 384-563
Classification Level Classification E-value
Superfamily Macro domain-like 8.58e-36
Family Macro domain 0.0005
Further Details:      
 
Domain Number 3 Region: 735-914
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.97e-27
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000393518
Sequence length 935
Comment PARP9 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 9
Sequence
MVSVSVELLERTKEVAHCIWELESTFGNTKESINSERPTGDLEDGLFHGKKHKHLHFMNL
DQYIDSYPYNSKKLKSLGAGAASSSKETGRIKSLSLLFKKGFAQVFPQWRKGKTEGDCVY
HNCTETDFSVQSFSWQIPINHSDFTILKNHESRLSDVLQTKFGCISTLISPALAGNSQPL
AQQVFRKRLSPGLELSVWKDDLTRHAVDAVVNAANEDLCHGGGLAGALVRAGGHEIQEQS
RRWVASYGKVPASEIAITGAGRLPCRLIIHAVGPRWEAMDSLRCIDKLQRVIARILQYVN
YENTSITTVAIPALSSGIFQFPLDLCTQTILQTIQWYLQGMQLVSNLKEIHLVSNEDPTV
AALKAASEVFLGENELGPWMSQETTPPVSIHTMQGLTLQIIQGHIEQQTTDVIVNSVNPF
DIKSEPVSKSILQQAGNEIEWELTDRIPKLLSVSKFVLVTEGFELSCRYVFHVLWHLTYP
KHLLLKNAVKECLEKCLELNKTSISFPALGTGSIGIKKNTVAEIMFDEVLTFAKYHLNEK
LTVKFVIFPEDLGTYKAFSAEMAKKSKMLSLNSHRVPHQWTREDQRENGLKDGSPGVNLM
GFNLEEMHEAEAWIQKILTSQDHHIIENNHILYLGKKEHEFLSDLQTTTSVCISEVISLE
KAKLEIKGAQTDCIEVVLKIERMLCEVQEEIVRKKEQGFKNLSGQWTDQQGKPQDEVKEV
KILFLRFPVLLTQELEEQKKQFEKHGLLVIKVEKIENMVLTAAFQRKKKMMEGRTHREPV
SRRLFQQVPRQFCNAVCRVGFQRLYSVPCDPKYGAGIYFTRNLKNLADKAKKTPATDKLI
YVFEADVLTGSFCQGHQLNIVPLPLSPGAIDGHDSMVDNMYSPETFVIFSGTQAMPQYLW
ICTQDHEQSQDYSSGPVMFSSQQPWGKFSRSSSVD
Download sequence
Identical sequences G5AV79
HGL_H00000393518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]