SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000394033 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000394033
Domain Number 1 Region: 309-454
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.07e-24
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 154-190,240-262
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000301
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000394033
Sequence length 526
Comment KCNK2 (Homo_sapiens) potassium channel, subfamily K, member 2
Sequence
MPNHPAADSQVCARPTKVLSHTEHAKSPRCTQEGLCMPYRGPESRGRHRITLLQTGSHLV
PHYKDAEDTRPPELSPAVPGPEILAVIRGIIKCSKGGSEIQKGQTDPNDGVTHGLDLKVA
APDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTAINVMKWKTVSTIFLVVVLYLIIGA
TVFKALEQPQEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSN
QISHWDLGSSFFFAGTVITTIGRIWMLHKAAFKHWQYHFQFAFRHLVPQCKYTGKHLPQH
MTLGINCENISKKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFV
VITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKE
EVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRKLSAELAGNHNQELTPC
RRTLSVNHLTSEREVLPPLLKTESIYLNGLTPHCAGEEIAVIENIK
Download sequence
Identical sequences G5BUR8
HGL_H00000394033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]