SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000394164 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000394164
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily vWA-like 3.5e-18
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 2 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.67e-17
Family TFIIH p44 subunit cysteine-rich domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000394164
Sequence length 392
Comment GTF2H2 (Homo_sapiens) general transcription factor IIH, polypeptide 2, 44kDa
Sequence
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFENHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLACTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTALARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNSSEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEMTLEEYKGERFCYGCQGQLKDQHVYVC
AECQNVFCVDCDVFVHDSLHCCPGCIHKIPTP
Download sequence
Identical sequences G5C0I1
HGL_H00000394164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]