SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000394312 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000394312
Domain Number 1 Region: 1300-1400
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.16e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000377
Further Details:      
 
Weak hits

Sequence:  HGL_H00000394312
Domain Number - Region: 237-353
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00034
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number - Region: 436-633
Classification Level Classification E-value
Superfamily Tropomyosin 0.00477
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number - Region: 1149-1340
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.003
Further Details:      
 
Domain Number - Region: 125-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0238
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 656-814
Classification Level Classification E-value
Superfamily Tropomyosin 0.0262
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000394312
Sequence length 1404
Comment EEA1 (Homo_sapiens) early endosome antigen 1
Sequence
QTPGRVGSQGSDLDSSTTPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYQAVHDAG
NDSKHGEAELALQRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDG
LVADSSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLRE
AAEQKVTHLTDELNKGATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERE
SEKLKDECKELQAKHANSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTHNNQNL
TEKLLKKELDYTQLEEKHNEESVSKKNMQASLHQKDLDCQQLQSRLSASETSLQRIQAEL
SEKGEAAQKLKEELSEVETKHQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETE
RQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKIK
QQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKERE
DLYAKIQAGEGETAVLNQLQEKNHMLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKA
HLRAAQDRVLSLETSVSELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQN
HLDTAQNALQDKQQELNKVITQLDQVTAKLQDKQEHCSQMESHLKEYKEKHLSLEQKTEE
LEGQIKKLEAETLEVKASKEQALQDLQQQRQLSTDLELKTTELSKQLEMEKETVSSTKLD
LLKKSETIETIKQMLAKEEEENAVLKQEIEKLSQDIKMQQEELNNRIQTAQTELKEVKTE
KEMLMTELSTAKDKLSKVSDSLKNSKREFEKENQKGKAAILDLEKTCKELKHQLQIQTES
TQKEQNELKKSLEKEREASHQLTLELNSIKEQVIEAQSTLKQKEKEQQQLQGNIKELKQL
IEQKKKQIEAHQGEVKIAISQKTELENKLQQQSAQAAQELAAEKEKISGLQNTYEKCQEN
LKQLQSDFYGKESELLATRQDLKSVEEKLSLAQEDLISNRNQIGSQNKLIQELKTAKATL
EQDSAKKEQQLKEQSKTLQDMQKEKSMKEKELVNEKSKLAEIEEIKCRQEKQITKLSEEL
KSHKQESIKEITNLKDSKQLLIQQKLELQGKVDSLKAALEQEKRNQQMLKEQMKKEEDEL
KKEFSEKEAKLHSEIKDKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSEL
EKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKFQTKVLELQRKLDNTTAAV
QELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSA
KNALTPSSKKPVRVCDACFNDLQG
Download sequence
Identical sequences G5B009
HGL_H00000394312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]