SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000395007 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000395007
Domain Number 1 Region: 107-165
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 465-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000635
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  HGL_H00000395007
Domain Number - Region: 481-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00428
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 19-91
Classification Level Classification E-value
Superfamily Tropomyosin 0.0373
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000395007
Sequence length 584
Comment ZNF746 (Homo_sapiens) zinc finger protein 746
Sequence
MLTSLFSFAKISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGN
QLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEVPVTFDDVAVYFS
EQEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIDQGKDPCTWRRTGPKIPD
VPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDVGEEPWGLSQLDS
GAGDISTDATSGVHSNFSTTIPPTSWQAELPPHHPSSACSDGTLKLNMAASTEADVKIVI
KTEVQEEEVVATPVHPTDLEAHGTLFAPGQAARFFPSPVQEGAWESQGSSFPGQDPVLGL
REPARPERDLGDLSPAVAQEETPPAGDWLFGGVRWGWNFRCKPPVGLNPRSGPEGLPFSS
PEGGEAILDPSQAPRPFPEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCTTCGKSFQL
QCEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHTGGAKTPARGQPL
PPVPAVPPDPFKSPAAKGPLAPTDLVTDWTCGLSVLGPTDGGDL
Download sequence
Identical sequences G5AML8
HGL_H00000395007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]