SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000395147 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000395147
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily PHP domain-like 8.24e-29
Family PHP domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000395147
Sequence length 222
Comment RPP30 (Homo_sapiens) ribonuclease P/MRP 30kDa subunit
Sequence
MVETAAHLGYSVVAINHVVDFKEKKQEIEKPVVVSELFTTLPIVQGKSRPIKILTRLTII
VTDPSHCNVLRATSSRVRLYDIIAVFPKTEKLFHVACTHLDVDLVCITVTEKLPFYFKRP
PVNVAIDRGLGFELVYSPAIKDSTMRRYTISNALNLMQICKGKKLEKLLLELFLQLRNLD
HQKGMMILFQLAKKLNVRAEENGPLFIGTAFFPFILHQPQQK
Download sequence
Identical sequences G5B100
HGL_H00000395147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]