SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000395986 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000395986
Domain Number 1 Region: 687-868
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-40
Family Ypt/Rab-GAP domain of gyp1p 0.005
Further Details:      
 
Domain Number 2 Region: 843-964
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.68e-34
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 10-40,133-262
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Weak hits

Sequence:  HGL_H00000395986
Domain Number - Region: 968-1053
Classification Level Classification E-value
Superfamily Tropomyosin 0.0262
Family Tropomyosin 0.0083
Further Details:      
 
Domain Number - Region: 257-318
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0536
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000395986
Sequence length 1094
Comment TBC1D4 (Homo_sapiens) TBC1 domain family, member 4
Sequence
MKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVAHKVAQSSLIDDCIEKFSLHEQQRLRLQG
ERAADPGEELVLEGEALGSPRDSLPEEEEEEEAENSHPALPALASQPVPSSARVCFPERI
LEDCGFDEQQEFRSRCSSVTGVLQRKVHENGQKPQPRRRHASAPSHVQPSDSEKNRTMLF
QVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQ
CASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLV
IQRHLSSLTDNEQADIFERVQKMKPISDQEENELVILHLRQLCEAKQKTHVHIGDGPLTI
SNSAVPENATSSGRFKLDILKNKAKRSLTSSLENIFSRDYSPGDSPPGTPPASPLSSAWQ
AFPEEDSDSPQFRRRAHTFSHPPSSSKRKLNLQDLRAHGVRSPLLRQSSSEQCSLLPSVR
RIHKESNSSSSLPSLHTSFSAPSFSAPSFLKSFYQNSGRLSPQYEHEIRQDTASESSDGE
GRKRTSSTCSNESLSVGGTPVIPRRISWRQRIFLRVASPMNKSPSAMQHPDGLDRNELLP
LSPLAPTMEEEPLVIFLSSDDDPGKVEEKKKSKELKSLWKKAIHQQILLLRMEKENQKLE
ARRDELQSRKVKLDYEEVGVCQKEVLITWDKKLLNCRAKIRCDMEDIHTTLKEGVPKSRR
GEIWQFLALQYRLRHRLPNKHQPPDTSYKELLKQLTAQQHAILVDLGRTFPTHPYFSVQL
GAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQY
RPDMTSLQIQMYQLSRLLHDYHRELYNHLEENEISPSLYAAPWFLTLFASQFPLGFVARV
FDIIFLQGTEVIFKVALSLLSSQETLIMQCENFESIVEFLKSRLPDMNTSEMEKIITQVF
EMDISKQLHAYEVEYHVLQDELQESSYACEDNEPLEKLERANSQLKRQNMDLLEKLQVAH
AKIQSLESNLENLLTRETKMKTLIRTLEQEKMAYQKTVEQIQKLLPADALANCESLLREL
NCNPNNKAKTGNKP
Download sequence
Identical sequences G5C5G5
HGL_H00000395986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]