SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000396032 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000396032
Domain Number - Region: 37-251
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000396032
Sequence length 1593
Comment KIAA0802 (Homo_sapiens) KIAA0802
Sequence
GAVDDGQGRVPPERAVPGTPQESGPGRRPRFGASLEEEELLREMEELRSENDYLKDELDE
LRAEMEEMRDSYLEEDVYQLQELRRELDRANKNCRILQYRLRKAEQKSLKVAETGQVDGE
LIRSLEQDLKVAKDVSVRLHHELETVEEKRTRAEDENETLRQQVIEVEIARQALQNELER
QKESFLKRRGSREMYKEKKTLSQDDSADLKCQLQFAKEEASLMRKKMAKLCREKDELEQE
LQKYKSLYGDVDSPLPTGEAGGPPSTREAELKLRLRLVEEEANILGRKIVELEVENRGLK
AEMEDLQVQHKQEGAGQDRVPRAPTSPFGDSLESCAELRRHLQFVEEEATLLRRSISEIA
AHNQQLTHELSKFKFEPCPEPGWRRDSLGKGTMAPLQEELRSARLQISKLSGKVLKLQSE
NLAMLSSAHLGLQAPSPRDSDANSDTGQKESDVEDGRLPQPKREGPVGGESDSDETVEKT
SGFGSRKPSEASEPCLAELRGPKDAEHLVALKRKARQLERTMEHLITDTDSFLRNSPGLQ
AEGERALGGQDEPHLLGAINRKMKAFRKELQAFLEQVARLGDSLSALPHHTESSSFLSTV
TSVPRDSPVGNLGKELGPDVQSRMRDQQEWRLGPDRGEDRDSAHLHTAQELHRRADGDTG
SHCPGGQSCFSPKMEEEHLYALRWKELEMQSLALQSTLHTRTWGEERMLLQQELGVLRQS
IFLFYLKLRWLLKHWRQAKQAGGSGEDGAEGEHPETLPGLGELGVQGCLQADGLEHSDGD
RGCAFPVGEAAPCAPVQIGDHASRLQTVDGAPLHRQVEHWQLFSTLKALLEDFRSELWED
ELARRRLQQQYASDKAAWDVEWAVLKCRLQQLEEKTEKSLGEPDAVVESKGALKREREAH
QKLLADSHGLVLDLRWQMHHREKSWRREKMELLERLDRERRAWEQQQQELAWRIEQLQKE
SSPQRGGSFPCDQKGGNLRPSPHPGGARGSRPLSAWHCEVTDSAPREDQPLSKLKESDRC
SASENLYLDALSLDTEQEEPPRPRGPKRTFRSHLPKEEDNHKRNLQRAMSVSSMSEFQRL
MDVSPFLPERGLAPASSRDDVTPPLSPDDLKYIEEFNSESWGYEVAPRAGLERPPDSWAD
RTTEGGRVGQETPAEPFPSSSWYLTTSVTMPTDTVSSPEHCRKQALHSHIIAEPSRVHVL
HSPPAIRRVDSIGPAAGAEGRGRLDPEGPSPSGRARGSLAEAKEPPTPGRWPCTPARQPR
DHVEGALCPLDLPLCAPLGLASPPHSLDMAKNMSDDTKAAAFSVRNALCSGPPRPRVKDT
ACQTNGSRVVGTQAVQTVSVGLQTEALRTGTITSSPHRCLTPKAGGGATPVSSPSRSLRS
RQVAPAIEKVQAKFERTCCSPKYGSPKLQRKPLPKADQPGSRTSAGAGQKGFSESAWARS
TTTRESPVHTTINDGLSSLFSIIDHSPAMQDAFQKGARAGSRPELGPGQETGPSSQGRLP
SPLGMGTETMGREDRGEGTPVRQDLSAPPGYTLAESVARILNRKLLEHALKEDRRQAAHG
RALNSDSLPGVAASAEPGAIENPPVLLTAPWGL
Download sequence
Identical sequences G5C058
HGL_H00000396032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]