SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000396402 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000396402
Domain Number 1 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 306-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 345-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 3-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 187-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000227
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000396402
Sequence length 408
Comment ZNF793 (Homo_sapiens) zinc finger protein 793
Sequence
PEIPVSFKDVVVGFTQEEWHQLNPAQRALYRDVMLETYSNLVSVEHSSLNCAFYYGSYTV
HTSNLRAFLKVDLLQLIISIKIHKNDSLVLSPEDIWQVDVQRKRQQDTFLRQGAFISKRA
LPQGKIHACDKFGKISLLSTDLLPSIQRPNNWDPCGKSLNDNLNLIGLKTNYAKKQDECN
GYGKLLQCSNHDKRSTGQKPWGCSHCEKAFSHNPALIYKPAVTSSLVYKRKRIPPAEKPH
VCSECGKAFCYKSEFIRHQRSHTGEKPYGCTDCGKAFSHKSTLIKHQRIHTGVRPFECFF
CGKAFTQSHRTEHQRTHTGERPFVCSECGKSFGEKSYLNVHRKMHTGERPYRCRECGKCF
SQKSCLNKHWRTHTGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYR
Download sequence
Identical sequences G5AMD4
HGL_H00000396402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]