SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000396578-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000396578-1
Domain Number 1 Region: 42-118
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000299
Family Canonical RBD 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000396578-1
Sequence length 369
Comment EIF4B (Homo_sapiens) eukaryotic translation initiation factor 4B
Sequence
MTWKEMFQPLGTVMTTMCTGHLQLTAPSFPLLHGLLGNPISTGAILPKSPPYTAFLGNLP
YAVTEDSIKEFFRGLNISAVHLPREPSNPERLKGFGYAEFENLDSLLSALSLNEESLDSF
DDYLPRRGDDSFGDKYRDCYDSDRYQDGYQDGPHRDMDRYGGPDRYDDQGSRDYDRGYNS
RIGSGRRAFGSGYHRDDDYRGGGDCYEDHYDRLDDRPWGSRDDYSQDDYRHDDRAAPPKE
NAWVKRSSNPPARSQSSDTEQQSPTSGGWKVVPAQPSEEGLARKDENKIDGMSVQKGQTG
NSSHGPGDGGNKDHWKESDRKDGKKDQDSRSVPEPKKPEENPSSKFSSESKYAALSVDDE
DENEEDYAD
Download sequence
Identical sequences G5APD8
HGL_H00000396578-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]