SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000397178 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000397178
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-19
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 208-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000629
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000103
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000397178
Sequence length 400
Comment ZNF300 (Homo_sapiens) zinc finger protein 300
Sequence
MLENYSHLVSMGYPVSKPDVISKLEQGKDPCIMKRDIPNWTYPDENHRGKRQRKKNNLHN
SQSCILGTVSFYNKILKGVTKDSSFYPILKVYHGDGQLQTCQENQDKLFRQVTFVSSKTV
FEASSHKYNALGKILQEYIKPDMPKERLHKYDSFKKNIKPNIDLPNCNTSNSKQNLDESF
DAAKSPIHHVSNSNIEKLHSGVIPCNDNLCENIFLNKQSLIQYQNVETKEKTCVCITCGK
AFAKKSQLIVHQRIHTGKKPYNCGACGKAFSEKFHLIVHQRTHTGEKPYDCSECGKAFSQ
KSSLIIHQRVHTGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQL
IIHHRAHTGEKPYQCTECGKAFCEKSHLIIHKRIHTGEKL
Download sequence
Identical sequences G5B724
HGL_H00000397178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]