SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000397555 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000397555
Domain Number 1 Region: 45-105
Classification Level Classification E-value
Superfamily R3H domain 0.00000000106
Family R3H domain 0.0041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000397555
Domain Number - Region: 324-389
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00654
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000397555
Sequence length 457
Comment R3HCC1 (Homo_sapiens) R3H domain and coiled-coil containing 1
Sequence
AGARRRLWTPTAAARRRAVAALSAVTLALLCLDGVFLSSAENDFVHRVQEELDRFLLQKQ
LSKVLLFPPLSSRLRYLIHRTAEKFDLLSSFSVGEGWKRRTVICHLDVRVLSSHGPCRPP
AGHPGKYHGPRPTSNQGAGAGPQGARAGWWHRGRKPDQPLYVPRVLRRQDDGAVTSTPGV
KGEAPAGGVLEESGDAGAGDPDADQGLPVLITQETADLKGPGQSFENETRLEPADTGPPG
PESPSGKACGVELAKQLGSSVQPALKEEDASQLEQILKDKEKEDEGEEGSCSEEERSELL
QEITANLTEKEIQVEKAQLDLSCFSEELPGEKDLAHVLEIYDFEPALRTEDLLATFSEFQ
DKGLKIQWVDDTHALGIFPCLASATEALTKDFSILKIRPLTEGTKQSKLRALQRPKLLQL
VKERPQTDAAVARRLVARALGLQHKKKERPSGPSNLP
Download sequence
Identical sequences G5B9R7
HGL_H00000397555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]