SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398108 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398108
Domain Number 1 Region: 722-779
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 269-331
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-18
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 3 Region: 664-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-18
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 533-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 768-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000101
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398108
Sequence length 823
Comment ZNF777 (Homo_sapiens) zinc finger protein 777
Sequence
MENQRSSPLSFSSAPQEEALRPAMAGLSRDALFSSCILPPKEIPALSPTGARQGPLPQTS
ASKQETSGQMPHAPPKGPSLLCPTASEQETQLQCPPTTQEEPQYPAEQDLSLLSHSAHQQ
EAPLHSPEVPEKDPLSLSPTVPEADMDPLLQSPTSQKDIPFPKEQPLPTAEITRLAVWAA
VQAVERKLEAQAMRLLTLEGRTGTNEKKIADCEKTAVEFANHLESKWVVLGTLLQEYGLL
QRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHFSEQXEWGNLSEWQKELY
KNVMRGNYESLVSMDYAISKPDLMSQMERGERPAMQEQEDSEEGETPTDPSTAHDGIVIK
IEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEQENALEESTEASG
EFSELKQMLVQQRNCSEGIVIKTEEQEEEEEDDDDDELPQHLQSLGQLSGRYEASMYPTP
LPGEMSPEREESPPPLQLGNPAVKRLAPPSHSHSHGHGHGHGHGHGHGHGRERPFTCMEC
GKSFRLKINLIIHQRNHIKEGPYECAECEISFRHKQQLTLHQRIHRVRSGGYSPERSPTF
TPKHALKPHPKSPSSGSGGGGGGSSKPYKCPECDSSFSHKSSLTKHQITHTGERPYTCPE
CKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGERPFKCPECE
KSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHCAECGKRFT
QKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLRTHTGE
Download sequence
Identical sequences G5AML9
HGL_H00000398108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]