SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398147 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398147
Domain Number 1 Region: 26-135
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-43
Family FKBP immunophilin/proline isomerase 0.0000625
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398147
Sequence length 138
Comment FKBP2 (Homo_sapiens) FK506 binding protein 2, 13kDa
Sequence
MRLSWVLTVLSICLSATATGSEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGT
EFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGG
ATLVFEVELLKIERRSEL
Download sequence
Identical sequences G5B6Q7
XP_004852587.1.39548 HGL_H00000398147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]