SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398321 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398321
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-36
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398321
Sequence length 183
Comment ANKRD39 (Homo_sapiens) ankyrin repeat domain 39
Sequence
MAAPHSCGNGLCCLCPDAVLGVQQTVEEMNFERGIWSAALDGDLARVKSFIQKAMDPSQP
DSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHG
SDPQLVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPDNTTLRDL
LTS
Download sequence
Identical sequences G5BMU7
HGL_H00000398321 XP_004844438.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]