SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398391 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398391
Domain Number 1 Region: 1181-1289
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000053
Family PLC-like (P variant) 0.079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000398391
Domain Number - Region: 1007-1068
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.034
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398391
Sequence length 1702
Comment CC2D2A (Homo_sapiens) coiled-coil and C2 domain containing 2A
Sequence
MFVLSYGSPSVLTASLGSCLSLMEFTENDEEADVGRWKKNSKAERHRKKKQPPTAGPGEM
VSEKAHGSSQQEPGQEESQTRLVSVPARRGPRSVTQFRPAESCVPRALTVAGDTLGPCIV
HVITAFLPAPRDTTSSPFQFQLLNQAGFCRVLLPHSRFTFPSLEFCQGLPPIPSTSRTGF
AEFSMRERMREKLQAARSKAESALLQEIPTPRPRRLRSPREKETETAFGTEPGKEIQATH
QEEDSQSYSRVKFHDAVRKIKSKPQAPPGYPSAEEAYNFFTFNFDPEPEEPEVKAKVRAR
DGTNQKEEEEEGEEEESPAGGVNKTDEEELLSGKDAEDLLLGLDPEADDSVAVRPAEYES
IHTWLEKEKEILFIPSRQAVPICEKLPENVQPRFPEDEGLYTGARPEVTRANQNVAESRL
LRQESGRKWFGDDGRILALPSPIRPFPSRPPRLAQEPSAKAGLETLYRKAVKYVHRTQHM
IGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLAAKLAQLYDQYLARHRRNKAKFLTDKL
QALRNAVQTGLHPEKPHQSLDATQKTVNEYKSEIRERNAEQEKDRTLLKTIIKVWKEIKS
LREFQRFTNTSLRLVLRKEKVDQKADEEAYEAEIQAEISELMEEHTEEYEQKMEAYRASY
QQWRAWKKAQKVKKKKKKQAEEHPEGQAEEESYPGEEPAKPVPPELPDQVALEQQVRERA
AHSRRRPSEPVLLPELSLAGSVTPNDQCPRVEVLRREDVKRRSVYLKVLFNSKEVSRTVS
RQLGADFRVHFGQIFNLQIFNWPESLTLQVYETVGHSSTTLLAEVFLPIPETTVVTGRAP
TEEVEFSSNQHVTLDHEGVGSGVPFSFEADGSNQLTLMTSGKVSHSVAWAVGDNGVPLIP
PVSQQNAGFRSALKRADAISSIGTSGLTDMKKLAKWVAESKLDPNDPNNAPLMQLISVAT
SGESYVPDFFRLEQLQQEFNFVSDEELNRSKRFRLLRLRSQEVPEFRNYKQIPAYDREIM
ERVFQDYEKRLRDKSVIETKDHMDTHRAIVAKYLQQVRESVVNRFLIAKHHFLLADLVVE
EEVPNISSLGLSLFKLAEQKRPLRPRRRGRKKVTAQNLSDGDIKLLVNICRAYDIPVRKP
AASKFQQPSRSSRTFSEKHAASPSAHSPNQSPDNPLGQVLVRPFVEVSFQRTICHTTTAE
GPNPSWNEELEFPFRAPNGDYSSASLQSVKDDVFINIFDEVLCDVLEDDRERGSGIHTRI
ERHWLGCVKIPFSTIYFQGRIDGTFKIDTPPVLLGYSKERNMLIERGFDSVRSLSEGSYI
TLFITIEPQLVPGESIQEKFDSQEDEKLLQATEKFQVECALKFPSRQCLTTVIDISGKTV
FITRYLKPLNPPQELLNAYPSNPQATAELVARYVSLIPFLPDTVSFAGICDLWSTSDQFL
DLLAGDEEEHAVLLCNFFLFLGKKAWVVMGNAIPEGPTAYVLTWEQNHYLIWNPCSGHFY
GQFDTFCPLKSVGCLIGPDNIWFNIQQYDSPLRINFDVTKPKLWKPFFSRSLPYPGLSSV
QPEELIYQHTDKTAAAELQDRIEKMLKEKIMDWRPRHLTRWNRHCISTLRHFLPLLERSQ
GEGVDDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLIEAVYSTGVHNIDVPNVEFALAVY
IHPYPKNVLSVWIYVASLIRNR
Download sequence
Identical sequences G5BGC0
HGL_H00000398391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]