SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398577 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398577
Domain Number 1 Region: 649-781
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000171
Family Synaptotagmin-like (S variant) 0.0049
Further Details:      
 
Domain Number 2 Region: 14-48
Classification Level Classification E-value
Superfamily WW domain 0.00000000133
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398577
Sequence length 1163
Comment WWC2 (Homo_sapiens) WW and C2 domain containing 2
Sequence
RLTKPLSFADCVGDELPWGWEAGFDPQIGVYYIDHINKTTQIEDPRKQWRGEQEKMLKDY
LSVAQDALRTQKELYHVKEQRLALALDEYERLNDAYKEKSSSHTSLFSGSSSSTKYDPDI
LKAEISTTRLRVKKLKRELSQMKQELLYKEQGFETLQQIDKKMSGGQSGYELSEAKAILT
ELKSIRKAISSGEKEKRDLMQRFHLDQNIGKSEPDLRSSSVNSHLSLSRQTLDAGSQTSI
SGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSKLDSEAWPGALDIEKEKLMLINE
KEEFLKELQFITPQKRTQDELERLEAERQQLEEELLSVRGTPSRALARRLKLEERRKELL
QKLEETTKLTTYLHSQLKSLSTSTLSMSSGSSLGSLASSRGSLNTSSRGSLNSLSSSELY
YSSQGDQIDVDYQYKLDFLLQEKGGYVPSGPITTIHENEVVKSPSQPGQSGLCGAPVAAT
GHTPTLTEAPKSVTSLSSRSSLSSLSPPSSPLVLEGTFSMSSHEASLHQFTTDFEDCELS
SHFADISLGENQILLDSDSGGISQSLLEDKELNKCAREPLFEGTTDVEKSLPKRRVIHLP
GEKTACVSAAVSDESVAGDSGVYEASMKQSNEIEDAPYSEEDAAIVETAQVQIGLRYDAK
SSSFMVIIAQLRNLHAFLIPHTSKVYFRVAVLPSSTDVSCLFRTKVHPPTESVLFNDVFR
MAISQTALQQKTLRVDLCSVSKHRREECLAGTQISLADLPFSNEIFTVWYNLLPSKQVPC
KKNEEESEDSAFQSNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEPGPEEEHQG
PEGDWLHCSWSMPAWLQVCFVLFHYRLTVLREASDEIVAEKEAEVKLAEDNSCTEDLSSC
TNLPGVNKDRCRKENECARDHTKELPTGIPILVDKETNTDEAVSDSMAVCPKDRSSLSSR
QHPFMRSSMIVRSQTFSPGERSQYICRLNRSDSDSSTLAKKSLFVRNSTERRSLRVKRTV
CQPVLRRTSQECPVRTSLDLELDLQASLTHQSRLNDELQALRGLRQKLEELKAQGETDLP
PGVLEDERFQKLLKQAEKQVWTSVLSSQKKSRAEKLMRQVSKDVCRLREQSRKVPQQVQS
FREKIAYFTRAKISIPSLPADDV
Download sequence
Identical sequences G5CB42
HGL_H00000398577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]