SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000398661 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000398661
Domain Number 1 Region: 6-110
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.84e-20
Family FHA domain 0.0017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000398661
Domain Number - Region: 600-794
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000398661
Sequence length 828
Comment SLMAP (Homo_sapiens) sarcolemma associated protein
Sequence
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF
DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC
IVSTIKLFLPDGMEARLRSDVIHAPLPSPVDKVAANTPSMYSQELFQLSQYLQEALHREQ
MLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKEL
IALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEEL
RELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKI
EALQADNDFTNERLTALQVRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQKKLI
VEGHLTKVVEETKLSKENQARAKESDLSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVS
LLKDDSQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEE
SAKQIQVLQAQLQRLHIDIENLREEKDSEVTSTRDELLSARDEILLLHQAAAKAASERDT
DIASLQEELKKVRAELDRWRKAASEYEREITGLQNSFQLRCQQCEDQQREEATRLQGELE
KLKKEWNVLETECHSLKKENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMTRKELEN
QVGSLKEQHLRDSADLKTLLTKAESQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITD
QLKQCKDNLKLLREKGNNKPWPWMPMLAALVAVTAIVLYVPGLARASP
Download sequence
Identical sequences G5BMH0
HGL_H00000398661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]