SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000399162 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000399162
Domain Number 1 Region: 142-692,868-1063
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-252
Family Motor proteins 0.00000000299
Further Details:      
 
Domain Number 2 Region: 2136-2324
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000577
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000951
Family Ras-binding domain, RBD 0.0096
Further Details:      
 
Domain Number 4 Region: 2070-2129
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000106
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 1112-1162
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000443
Family Motor proteins 0.049
Further Details:      
 
Weak hits

Sequence:  HGL_H00000399162
Domain Number - Region: 1062-1116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00066
Family Motor proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000399162
Sequence length 2623
Comment MYO9A (Homo_sapiens) myosin IXA
Sequence
MNISDGGRRRFEDNEHTLRIYPGTISEGTIYCPVPARKNSTAAEVIDCLINRLNLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRSSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKRNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEERLAFHLKQPEE
YHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFESLVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEHNTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEENSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFICGMIGIDPVAVFRWAVLRAFFRATVAFREAGK
RHIQRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGVNTLNEKNQHDTFDISWNVRPGIRQSKLTANTSLLDKDGIFANSASSRLLERAHGIL
TRNRNFKTKPALPKHLLDVFSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLGQAEPYFVKCIRSNAEKLPLRFNDALVLRQLRYTGMLETVRIRQSGYSCKYSFQD
FVSHFHVLLPQNIIPSKFNIQDFFWKINVNADNYQVGKTMIFLKEQERQHLQDLLHQEVL
RRIVLLQRWFRVLLCRQHFLHLRQAAIVIQRFWRNYINEKQVRAAAVQKGAFVMASAATL
LQASWRAHLERQRYLELRAAAIVIQQRWRKLCRHRHMAATCIQARWKGYRESKWYQEQRN
AIILLQSTCRGFAARQRFKALKEQKLKETKLEHGLMNIKAFGALEVQGSDPSEWEDCSFD
NRVKAIEESKSVIDSNRIGHDSSVEGSEESPDKRQERARSQSGMDLQQEVIVRERPKSLE
DLHQKKVVRAKRESRRMRELEQAIFSLELLKVRSLGGMSPSEERRWSTELMPEGLQSPQG
TPDSESSQGSLELLSCEDSQKSKLESIILDEGHLQVPSPKIPCSPKSDLQDNALSASSDT
RSVWIQKGASSDSEPLKNGSVQEKRFCGSEPITCKPQQRDSSMSNSLPTFFYIPHQDALK
QLDPASIQRNKYLEHDHTLRTAHTLDFSREGRKSHFSGDQVVPSLNMDSSNNVLMKLEKL
NIEKEERQKQLQQQNEIEMMEQIRQQTDILEKERKAFKAIEKPRAGESFLTPSFCQSKPR
AKRPSSLFIPSTPDKGEPSGLGAPSVTVKDAAFASKDSPSVHLPLKDRPVTLFFERKGNL
CQSITVRELSKTERMGTQHDIPCKLSNNHFSKREHLTPGQSYGHKSEDPSREESTRTIFF
TSKDNTSIPVVNKEALTSGNPQVHKQDESAWKPVKLAGSGQREVARPAHKKKARMARTRS
DFLTRGTFADGEGDTEEDDYDDIIEPHLSLDQASRSELGSASSLGQASHSDSEMTSQRFS
SVDEQAKIHKTMSQGEITKLVVRQKSSDLDIRPQRARMRFWAKGKQGDKKTTRVKPATQS
EVLPLFAGSDVIPAHQFPEELAQYQPTPPLSPELPGGCQKEFKENKEPSPKVRRKRSVKI
SSVAVDSIHWQNESVQIIASASDLKSMDEFLLKKMNDLDNEDSKKDTLVDVVFKKALKEF
RQNIFSFYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDWSESPVRVWVNTFKVFL
DEYMNEFKTSDSIATKVPKTERKKRRKKETDLVEEHNGHVFKATQYSIPTYCEYCSSLIW
IMDRASVCKLCKYACHKKCCLKTTAKCSKKYDPELSPRQFGVELSRLTSEDRTVPLVVEK
LINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDL
PNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDT
NRMSANALAIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSL
EFAENKAKTRLSLIRRSMGKGRIRRGNHPSPSSPVVVRLPSVSDVPEETLGSEATMETDI
TEQQQAAMQQEERVLTEQIENLQKEKEELTFEMLVLEPRASDDETLESEASIGTADSSEN
LNIESEGTKSKRSERSLGLSSLKAAAKSEPSGKMRKQLKKQQDSLDFVESTCLSNTASSH
GTRKRFQIYSKSPFYRAASASEAPGMEGPLGQTKSLEDKPQFISRGTFNPEKGKQKLKNV
RNSPQKTKETPEGTVVSGHRKAVDPDCSSAQQLALFGNNEFMV
Download sequence
Identical sequences G5C6U1
HGL_H00000399162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]