SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000399851 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000399851
Domain Number 1 Region: 710-972,1012-1167
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.01e-78
Family DNA polymerase I 0.0026
Further Details:      
 
Domain Number 2 Region: 144-277,309-411
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000101
Family DnaQ-like 3'-5' exonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000399851
Sequence length 1214
Comment POLG (Homo_sapiens) polymerase (DNA directed), gamma
Sequence
MSRLLWKKVASVTVGAGPVPVLGRWASSSVHVPVPSDGQLQSQQLQGPSSEGGQLRHNPL
HIQMLSRGLHEQIFGCGGPKPDEAAVRRSVEHLQRHGLWGQPATPLPDVELRLPPLYGGS
LDQHFRLLAQKQSLPYLEAAESLLQAQLPPQPQSWAWAEGWTRYGPEGEAVPVDIPEERA
LVFDVEVCLAEGTCPTLAVAISPSAWYSWCSRRLVEERQLSPADLIPLEVPAGASSSTQQ
DWREQLVVGHNVSFDRAHIREQYRIQGSHMRFLDTMSMHMAISGLSGFQRSLWMAAKQGK
RKAQHPTQRGQKSPGKTTGPEISCWDWVDISSVNNLADVHSLYVGGPPLEKEARELFVKG
SMKDIRENFQDLMQYCAQDVWATYEVFQQQMPLFLERCPHPVTLAGMLEMGVSYLPVNQN
WERYLAEAQSTYEELQREMKKSLMDLANDACQLLSGERYKEDPWLWDLEWDLQEFKQKKT
KKVKKEEPVTASKLPIEGAGAPGDPTDQEDPGPPSEEEEFRQNITAQACLQQLKGTTELL
PKRLQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMAMTWDGFPLHYSERHG
WGYLVPGRRDNLAKVPESAGVACPYRAIESLYQKHRVEQGKQQLLPHEAGLAEEFLLTDS
STMWQTVEELGCLDPEAEAIVENLPAAGPALPLVLTAAGGPKGSQPTYHHGNGPYNDVNV
PGCWFFKLPHKDGNSFNVGSPFAKDFLPKMEDGTLQAGPGGASGPRALEINKMISFWRNA
HKRISSQMVVWLPRSALPRAVTRHPNYDEEGRYGAILPQVVTAGTITRRAVEPTWLTASN
ARPDRVGSELKAMVQAPPGYVLVGADVDSQELWIAAVLGDAHFAGIHGCTAFGWMTLQGK
KSNGTDLHSKTASTVGISREHAKVFNYGRIYGAGQPFAERLLMQFNHRLTRQEAAEKAQQ
MYAITKGLRWYRLTEEGEWLVQQLALPVDRTEDGWVSLKDLRKIQREAIRKSRRKWEVAA
ERVWMGGTESEMFNKLESIAMSDTPQTPVLGCRISRALEPSTVREQFMTSRVNWVVQSSA
VDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFA
YKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNQNGMERRYGIPQGEALDIYQIIE
LTKGSLEKRSQPGP
Download sequence
Identical sequences G5CA92
HGL_H00000399851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]