SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000400398 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000400398
Domain Number 1 Region: 1463-1554,1650-1689
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.12e-26
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 
Domain Number 2 Region: 974-1108
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-18
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 3 Region: 1678-1844
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.08e-17
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 4 Region: 232-371
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.64e-16
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 5 Region: 394-504
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000491
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 
Domain Number 6 Region: 5-114
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000156
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 7 Region: 1145-1246
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000385
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Weak hits

Sequence:  HGL_H00000400398
Domain Number - Region: 1964-2003
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.034
Family ABC transporter transmembrane region 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000400398
Sequence length 2014
Comment FER1L4 (Homo_sapiens) fer-1-like 4 (C. elegans)
Sequence
MALTVCVRRLIGLPGTHDRQVKLSFRGFTQKTRKIHCGREADVGELFRWPHYGAPLPGEN
LSVQVVNCSHVFSPRSLGTLVISLQQLQSAGHLVIREALVDKNLQVSPIQVELDLKYQPP
EGAAGAWAEEDFGSTIRDSSELIIPNVGFQELEPGEARLERRAVALGRRLARSLGPQDDE
ENELELELELELDDEPDVELSGVVFSPLKSRARGLAHRDHFQVSRAQDFQVGVTVLEAQK
LVGVNINPYVAVRVREQRRVTATQRGTNCPFYNEVGENEYFLFEFHETRLRLQDSLLEIT
AFHSQTLPFMATRIGTFRMDLGIAFDQPDGLFYQKWAPLHDPRDTHAGIKGFVKVTLSVK
ARGDLPPPLPPPGLGHSSDIEKNLLLPRGVHAERPWARLRVRVYRAERLPALRPGLLGSL
TRALHDQRVLVDPYVRVSFLGQQGETSVRGAAVAPEWNEQLSFVELFPPLTRGLSLQLRD
DAPLADVALATHVLDLRQISHPGRAAGFNPTFGPAWVSLYGSPPSGGLRDGLQSLNEGLG
QGLWFRGRLLVAVSMEVFEGRAESEPPQAPQGSKLSRLTGKKKKARRSQAAAGVPQQHGD
AGSRGDGPEIPSAMEVEVEELLPLPENALAPCEDFLLFCVLFEATMIDPAVASQPISFEI
SIGHAGRREEQRHRGSRAGEGTTGSMGEVQPLLESEDTGARLEEEEEEELGTPAQRPEPV
DGSGPYFCLPLRHCKPCIHVWSHWEDYTWRLQSSNCVYKVAERLDQGLQEVEKMQRKPGL
GACPRLKQALEELVAGSRQFCRSAECRTMTRPNALDRSRAKLLMHSLVLGWNVLAKQGLR
LLRGLKQSNMQKKVALAKKLLAKLRFLAQEPQPPLPDVLLWMLSGRRRVACARIPAQDVL
FSVVEEERGRDCGKIQSLLLTAPGAAPGEVCAKLELFLWLGLGKQAKACTSELSPDLLPE
PSAGLPHSLYRDDFSYFQLRAHLYQARGVLAADDSGLSDPFARVLISTQCQTTRVLEQTL
SPLWDELLVFDQLIVDGRREHLQQEPPLVVINVFDHNKFGPAVFLGRALAAPRVKLTEDP
YQRPELQFFPLKKGARGAGELIATFELIELDYSGRLEPSVPSDVEPQDLTALLEPLSGCL
SLPPSVRPVLREFRVEVLFWGLRGLGRVHLFEVEQPQVVLEVAGKRVESEVLPSYHDSPN
FTELVRHLTVDLPEQPYLQPPLSILVIEHRAFGRTVLVGSHIVPHMLRFTLQGNEDPPEE
EGAEEETEDSEPKGPQGPPKSYPFLAEAGISRWLLKVPLKKLTLGGLLSQGPELEEDIPD
PEELDWWSKYYASLQELQTQPNRDEEEMDDPGDSDGVNFISADGEAQDQDEADVEGTVSR
KKAVATLKIYSSSLEEEFNNFEDWLNVFPLYRGQGGQGGDGEEEGPGYFFGKFKGSFLIY
PESEAASFSEPQISRGIPQNRPIKLLIRVYVVKATNLAPADPNGKADPYVVVSAGKERQD
TKEHYIPKQLNPIFGEVLELSISLPAEPELTVAVFDHDLVGSDDLIGETHIDLENRFYSH
HRANCGLASQYDVDGYNAWRDAFRPSQILAGLCQRCGLPAPEYRAEAVKVGSKVFLTPPE
TLPTGGGGPQLANGTSEEAQALLVLRRWQEMPELGIQLVPEHVETRPLYHPRNPGLLQGS
LHMWIDIFPKDVPAPPPVDIKPRQPISYELRVIIWNTEDVVLDDVNPLTGEMSSDIYVKS
WVKGLEHDKQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVRRRPGPFALEEAEFRQ
PAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARDPAQCSVRLARDSAAPRCNLFRCRR
LRGWWPVVKLREAEDVEREEREAKASKKRKRRRKGRPEDLEFTDSGGNVYILTGKVEAEF
ELLTVEEAEKRPVGKGRKEPEPLEKPNRPKTSFNWFVNPLKTFIFFILRRYWRILVLLLV
LALITVFLLLVFYTMPGQISEVIFRPLHKPSDSN
Download sequence
Identical sequences G5B849
HGL_H00000400398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]