SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000400843 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000400843
Domain Number 1 Region: 313-820
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.2e-145
Family Lysophospholipase 0.000000494
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.04e-23
Family PLC-like (P variant) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000400843
Sequence length 821
Comment PLA2G4F (Homo_sapiens) phospholipase A2, group IVF
Sequence
MLGDLWARWLAGKGLPLLGAVALPKREKRAPQQRHGQRETHPYYDLQVKVLRARNIQGTD
LLSKADCYVQLSLPTASPSPVQTRMVANCSDPEWNETFCYQIHGAVKNVLELTLYDKDVL
SSDQLSLLLFDLRSLKPGQPHRHTFSLTQQGSQELQVEFVLDESQEQAPEVITNGVLVAH
RCLRVHGTLEGDRTIPQREYGSRQVELAVPGAYEKPQLLPLQWPEEPGLSPTFTFHVNPV
LSSWLDVELKEKLRVLQSGPRAELEPQTSKLGQGSFLLSSLPLGREERRLVGLGEGQEVA
LWVKAEMSSGDLDLRLGFDLCDGERKFLVKRKAVVAQALQQVLGLSEAPHGDQVPVVSVL
GSGGGTRAMSSLYGNLVGLQELGLLDAVTYLSGVSGSTWCISTLYKDPAWSCMALQGAIA
RARARVCSSKMGAMSMEQLQYYAQELGAQERESSGHGASLIDLWGLLIEYFLNQEENPAK
LSDQQEAVSQGQNPYPIYAGINVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTKLLGSE
FFMGRLLELRPEPRICYLQGMWGSAFAASLDEIFLKTAGSGLGFLDWHRGSVNITDECPQ
SQPHDPSRLRTRLFTPQGPFSQAVLDMFTSRFASTQNFNFMRGLCLHKDYAACRDFVAWK
GTHPDALPNQLTPMRDGLCLVDGGFAINSPFPLTLLPQRAVDLILSFDYSLEAPFEVLQM
TEQYCLDRGLPFPRIEVGPEDVAKPRECYLFAEAEDPQAPIVLHFPLVNRTFRTHLAPGV
ERRTAAEKAFGDFVINGPDTPYGMMNFTYEPKEFDRLVALN
Download sequence
Identical sequences G5BM24
HGL_H00000400843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]