SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000401371 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000401371
Domain Number 1 Region: 99-190
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.52e-30
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-25
Family Canonical RBD 0.0000242
Further Details:      
 
Domain Number 3 Region: 206-314
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-23
Family Canonical RBD 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000401371
Sequence length 386
Comment TIA1 (Homo_sapiens) TIA1 cytotoxic granule-associated RNA binding protein
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE
DIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN
WATRKPPAPKSTYESNTKQLSYDEVVSQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQI
MEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI
GYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSTPWMGPNYGV
QPPQGQNGSMLPNQPAGYRVAGYETQ
Download sequence
Identical sequences G5C6V4
HGL_H00000401371 XP_004849968.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]