SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000401445 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000401445
Domain Number 1 Region: 550-830
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-56
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 6-210
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.73e-17
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000401445
Sequence length 956
Comment ERN1 (Homo_sapiens) endoplasmic reticulum to nucleus signaling 1
Sequence
LQIFASTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPD
PNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQ
QTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDGDYKMS
HFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKVMHINVAVETLRYLTFM
PGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVVVVPRGSTLPLL
EGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNYWLLIGHHETPLSASTKML
ERFPNNLPKHRENVIPAKKSFEEVINLVDQTSENAPTTMFQDVEEKLAHAPAKPEAPVDS
MLKDMATIILSTFLLVGWVAFIISYPLSIHQQRQLQHQQFKKELEKIQLLQQQQLPFHPP
GELTQDTELLDTSSPYSESSGTSSPSPSPRASNHSLHSSSSASKAGTSASLEQDDKDEET
SMVIVGKISFCPRDVLGHGAEGTIVYRGMFDSRDVAVKRILPECFSFADREVQLLRESDE
HPNVIRYFCTERDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHS
LNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPE
MLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGAYSLDCFHPEKHE
DIIARELIEKMITMDPQQRPSAKHVLKHPFFWSVEKQLQFFQDVSDRIEKESLDGPIVRQ
LERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPVEVQET
LGSLPDDFVRYFTSRFPHLLSHTYWAMELCSHERLFQPYYFHEPPEPPPPVTPDVL
Download sequence
Identical sequences G5BDI0
HGL_H00000401445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]