SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402044 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402044
Domain Number 1 Region: 108-462
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.74e-63
Family Ankyrin repeat 0.0000444
Further Details:      
 
Domain Number 2 Region: 570-618
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000667
Family SOCS box-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402044
Sequence length 620
Comment ASB2 (Homo_sapiens) ankyrin repeat and SOCS box-containing 2
Sequence
MAMQISSRGRERAIGNEEYSLYSSLSEEELIQMAIEQSLVDKTRGSTLPEGTGSARANHQ
PAHFYPWTRSTAPSESLPARSSMGLFQGVMQKYNSSLFKTSQLAPMDPVLKAIKEGNEEA
LKAMIKDGKNLGEPNKEGWLPLHEAAYYGQLGCLKVLQQAYPGAIDQRTLQEETALYLAT
CREHLDCLLSLLQAGAEPDISNKSRETPLYKACERKNTEAVRLLVQHHADTNHRCNRGWT
ALHESVSRNDVEGMEILVSGGAKVEAKNAYGITPLFVAAQSGQLEALRFLAKHGADINTQ
ASDSASALYEACKNANKANKDGLLPLHIASKKGNYRIVQMLLPVTSRTRVRRSGISPLHL
AAERNNDGVLEALLGARFDVNAPLAPERSRLYEDRRSSALYFAVVNNNVYATELLLQAGA
DPNRDLINPLLVAIRHGCLRTMQLLLDHGANIDAYIATHPTTFPATIMFSMKCLSLLKFL
LDLGCDGEPCFSCLYGNGPHPPAPQRSSRFSEAYTTDKAPGMVQFCEILSAPEVSRWAGP
IIDVLLDYVGNVQLCSRLKEHIDSFEEWAVIKEKAEPPRPLAHLCRLQVRKAVGKCRLKL
LDTLPLPGRLIRYLKYENTQ
Download sequence
Identical sequences G5AXI9
HGL_H00000402044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]