SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402110 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000402110
Domain Number - Region: 49-158
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0317
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402110
Sequence length 1593
Comment C3orf63 (Homo_sapiens) Uncharacterized protein C3orf63 (Retinoblastoma-associated protein RAP140)(CTCL tumor antigen se89-1)
Sequence
MIKEAELHQDATFTSKEAQEAKKVSRSQHPEGSSPAAIPGSQGQEALFQPLTPGSREFED
VLNILHSSYLEPSSVTNFHYKRACLIHNELLEKEFTEKRRELKSDGRLDKELSESYAFLM
VDRYQVQNICEKGLQVGQSKITILGSPSMGIYLSKYADLLQANPLEAGAVGDVVIFKIMK
GKIKSIYDPMGVKSLESMLNKSALDPTPKHECHVSKNAGRITSLLAYRAYELTQYYFYEY
GFDELRRRPRHVCPYAVVSFTYRDDIQTPKFVSSSRSNSFNADRHIEKFNYTLWKGQLLN
KGKLLCYISLRSATRAFLPIKLPEKLDIETVVSIDHLKQKIPPSLFYKGTYVGPNEVLKN
GMYCSLYEVVEKTRIGSNMESLLQKLDKEKLALVKPLGDRGFLFLFSPYQMVSPYEHQTV
KSRILHALFLFQEPRGIITSQKLSTNPAPQERHEHESVPDILRIAQFLQFALIHCRKEFK
SINTINFHSVVEKYVSEFFKRGFGSGKREFMFSYDSRLDDKKFLYSAPKHKSHIDDCLHT
YIFRPEMYQLPICKLKELFEENKKLQQFSPLSDYEGQEEEMNGTKMKFGKRNNSRRETTS
PGKQKSCHSLDYDKDRVKELINLIQCRKKNVGGDPDTEDMRSKTVLKRKLENLPENKRKV
AKTSNLSENYHLYEESPQPVGLVGHDADLRRQQQDTCNSGSGDIHRLFNWLSETLANARH
SDASLTDTVNKALGLNTDDAYEELRQNHEYKLNSVSDKKGYEQPTCIKIENVHFKGVQSP
LLEVNTSSLKYPVAVSSEVGIDHKLHLKEDPNLINVNNFEDCSLCPTVPIEHGFHRQQSK
SSNVEETEIHWKLIPITGGDTRSPEDQLGKHSEKQTSGMKSPDEQLVCLPPQEAHPNDPR
VISRQRSSDYQFPSSPFTDTLKGTTEDDVLTGQMVTMEEQCASAEPSTVSESTERTVLGE
YSLFSRKIEEILKQNNVLYISKIPTPMFSTQEKLKRLSKFIYSETSKAGIQEFVDGVHEK
LNTVIIKASYKGGNLPPVNSNDSGTTKTLNPLERHVVSVSSSDYNNKHLLEPVCSDALKD
ANSQEQHSSSTLGLTEGEMNQPHHATELMVTSDHTVPGDSAREPEEKETQSPNDVNISAQ
PALSNFISQLEPEVFNSLVKIMKDVQKNTVKFYIHEEEESMLCKEIKEYLIKLGNTECHP
EQFLERRSKLDKLLIIIQNEDIAGFIHKVPGLVTLKTLPCVSFAGVDSLDDVKNHTYNEL
FVSGGFIVSDESILNPEVVTIESLKIFLTFLEELSTPEGKWQWKVHCKFQKRLKELGRLN
GKALSLLTLLNVYQKKHLVEILSYHSCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKN
IKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSIAEESLPFLGVNENLESQSALLENDEK
DEEDMSLDSGDEISHIEVCSNSHSEILAKENTGSSGRNQKKNTQIGLQSSLDVQKSLLED
KTSQIDSEESTSVDRVCPEGENSNSAEQDLYSVFQVSQSPLNMSHQFSHFNVLTHQTFLG
TSYPLSSSQTEENENSFLSAYTQCTSPLDWRKK
Download sequence
Identical sequences G5ATM7
HGL_H00000402110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]