SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402140 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402140
Domain Number 1 Region: 13-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-47
Family FCH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 438-498
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-24
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 3 Region: 302-367
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000549
Family HR1 repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402140
Sequence length 506
Comment NOSTRIN (Homo_sapiens) nitric oxide synthase trafficker
Sequence
MRDPLADCSYNKAYKSLKELSQNGENFCKQITSVLQQRANLEISYAKGLQKLATKLSKVL
QGTKKNCLSSAWLWASEGMKSTAELHQRLGKAIELEAIKPTYQVLSMQEKKRKSLDNEVE
KTANLVISNWNQQIKAKKKLMVSTKKHEALFHLIESSKESVTKKEKQKLLNKLKKSTEKL
EKEDENYYQKNMAGYSTRLKWEDTLENCYKSILELEKERIQLLCNNLNQYSQHISLFGQT
LTTCHTQIHCAISKVDIEKDVQTLMEETVMLSTENKSEFLLTDYFEEDPNNAMDKERRKS
LIKPKLSRLQRDIEKASKDKEGLERMLNAYSSNSSFSDEKSQKDTAALMVENNLKLDLLQ
ANSYKLLSVLAELEQRTKPSHPCSNSIFKWKEKEHTHTYVKISRPSLTKRSENVLSRTSS
GGQKNPSSSSSASSAAQVGNNLCKALYSFQARQDDELNLEKGDIVTIHEKKEEGWWFGSL
NGKKGHFPAAYVEELPSKAGSTATQA
Download sequence
Identical sequences G5C8R2
XP_004857669.1.39548 HGL_H00000402140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]