SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402616-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402616-1
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000151
Family Ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402616-1
Sequence length 593
Comment ANKRD13D (Homo_sapiens) ankyrin repeat domain 13 family, member D
Sequence
RHRELEAALHSRQHDLEQEDPRGRTPLELAVSLGNLESVRVLLRHNANVGKESRQGWAVL
QEAVSTGDPEMVQLVLQYRDFQRATQRLAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVS
KMCPSDVYRVWKRGESLRVDTSLLGFEHMTWQRGRRSFIFKGQEAGALVMEVDHDRQVVH
TETLGLALHEPEALLAAMRPSEEHVASRLTSPIVSTHLDTRNVAFERNKCGIWGWRSEKM
ETVSGYEAKAGEAVVYSATNVELVTRTRTEHLSDQDKSRSKGGKTAFQSFLGMAQQHSSH
SGAPVQQAASPTNPTAISPDEYFNPSFSLESRNIGRPIEVSSKVQRFKATLWLSEEHPLS
LGDQVTPIIDLMAISNAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDE
PLSSVWVPAPSSALATPGSPFPCEVDPTVFEIPEGYSVLGAERSEPLRDEDDDLLQFAIQ
QSLLEAGTEAEQVTIWEALTNSRPGAHPPPQATVYEEQLQLERALQESLRLSTESRGPGS
PERTPPSLAPSSFEEQLRLALELSSQEQEERDRRGQQEEEDLQRILQLSLTEH
Download sequence
Identical sequences G5BSB4
HGL_H00000402616-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]