SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402918 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402918
Domain Number 1 Region: 200-243
Classification Level Classification E-value
Superfamily LysM domain 0.0000000157
Family LysM domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402918
Sequence length 970
Comment OXR1 (Homo_sapiens) oxidation resistance 1
Sequence
MGGRPPVIPEAHEGTCEKQIEATTKTGGAASEAEVLAAHAEWVLETPWLRLRGTLMQESE
QADSNPDPRALRVSFLRGLSFADIQEHRGPQDEKQTLSLAFSAFQIGNPVSCSDPTARHS
WLGYRHVGGSALEWKEQAWATCQAPLGSLCVEIAWRAVVCVKREANISMVYVLADTGQKK
NLEKKDGRRMSFQKPKGTLEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRSVVTGQVL
YVPDPEYVSSAESSPSLSPISPLSPTSSEAEFDKTANLDAVHPKEATPSSTLTGIRLAQV
VSSTSEEEEAFTEKFLKINCKYITVGKGTVSGVLLVTPNNIMFDPHKADPLVQENGCEEY
GIMCPMEEVMSAAMCRDILDSEVKESFPGEIDLLSGKDFCHLKKIKEMNTKEIDLRTRDA
GIDSASTAPRSMEEGLSEDVFMESELSAIREEHSSDKSSGTSSDSVQTVCQTEVGGLTAQ
PESSNPPAHLKANTGHSAKGVGAVSNERDLSHLEMASQDGERVTDKLQEASGPTEASPIV
KGHTDQGPLPHEHSLQQDRGGRENLSCGEATEFEQKQTIDKGQEGKEQSWNSETEVEELR
KLWKTHTMQQTKQHRENIQQVSQKEMKHKTASTDGHVEGSAAPEEKRRHRLHKFLCLRVG
KPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDIGEYTR
EPGFIVVKKTEESETNEDPTSQAAARDWEVVSVAEYHRRIDALNTEELRTLCRRLQITTR
EDISSKQAAPAKAELESESFRPNLSDPSELLQPDHIEKLTKHLPPRTIGYPWTLVYGTGK
HGTSLKTLYRAMAGLDTPVLLVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEF
EVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFF
IQDIEIWSFE
Download sequence
Identical sequences G5AZ80
HGL_H00000402918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]