SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000402985 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000402985
Domain Number 1 Region: 58-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-17
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-16
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 101-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000493
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000402985
Sequence length 137
Comment ZNF69 (Homo_sapiens) zinc finger protein 69
Sequence
EAVTLEAVAVNFTMEEWAVLNLSQKKLYRNVMWETLMNTTAIGRTWGKPQIEGECKNCSR
SLRIYERFHMEEKTYVCKQCGKAFSRHCQCQIHERTHTGEKPYACRQCGKAFSRCSSCKI
HERRYTRKKPYVCKQCG
Download sequence
Identical sequences G5BWV2
HGL_H00000402985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]