SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403397 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000403397
Domain Number 1 Region: 53-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.6e-59
Family Ankyrin repeat 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403397
Sequence length 633
Comment ZDHHC17 (Homo_sapiens) zinc finger, DHHC-type containing 17
Sequence
MQREEGFNTKMADGPDEYETEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD
IIKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG
GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG
QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV
ISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE
FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
GIYLATKFWMYVTWFFWFWNDILCFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQ
KKKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNH
RYFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSV
FHFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCIRNIIDFFE
FRCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Download sequence
Identical sequences G5C9I2
HGL_H00000403397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]