SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403476 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000403476
Domain Number 1 Region: 80-164
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 2 Region: 165-242
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-22
Family SH3-domain 0.00054
Further Details:      
 
Domain Number 3 Region: 3-59
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000144
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403476
Sequence length 539
Comment C1orf113 (Homo_sapiens) SH3 domain-containing protein C1orf113
Sequence
MEVLVLDRYRAQKEDELSLEPGDVVRLVCQGPARSWLRGELGGRCGLFPKRLVQEIPEAL
RVSGDERPHCARRRRHSSKSRGPQRWCKVNFNYSPEQADELKLQTGEIVEVIKEIEDGWW
LGKKNGQLGAFPSNFVELLDSGPPSLGNTDLPPVSPGSQQTPKVLTYDSAPDYLHTVSHP
ETYRALFDYQPEAPDELPLQRGDEVKVLRKTTEDKGWWEGECRGRRGVFPDNFVLPPPPV
KKLVPRRVASLESVPTKEPKKLMARRSLLTVKKLMTAPSGPSKAKTPCGDSQKRLSRDAG
SSGRFLSGGPGQPGRKRSKTQAPRQHSAPSQGDHSSLTKAPCVTRAPTLDKTSTREKTPS
PNKARNPAKIPTSDKVSTPQKTLTLDKNSTPERVFSVDRAPALQVPPKDEALGPKPNSSE
RCCCLSLFQGESKFQPGSVPALEKALSLEEAAALQEEAPAKEEPTPKDSKEVAPKEQIAP
DPHTPHAIKQTPDPQKTPTLHSLVVQNSGNKNDGVDVMSLMHEVTSLRSALERLGLELE
Download sequence
Identical sequences G5C6F9
HGL_H00000403476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]