SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403487 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000403487
Domain Number 1 Region: 177-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.92e-47
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-36
Family Ankyrin repeat 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403487
Sequence length 452
Comment ILK (Homo_sapiens) integrin-linked kinase
Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Download sequence
Identical sequences A0A1U7T178 E2R5H4 F7BZE6 G1SRA9 G5BBQ5 I3MHP1 L8YC71 M3WMI0
ENSCAFP00000033861 HGL_H00000403487 9615.ENSCAFP00000033861 9796.ENSECAP00000005609 9986.ENSOCUP00000005697 ENSECAP00000005609 ENSSTOP00000010427 ENSOCUP00000005697 ENSOCUP00000005697 ENSFCAP00000014268 ENSSTOP00000010427 ENSTBEP00000000203 XP_001504649.2.31192 XP_002708812.1.1745 XP_004413373.1.74151 XP_004413374.1.74151 XP_004413375.1.74151 XP_004413376.1.74151 XP_004418428.1.5094 XP_004642103.1.9945 XP_004642104.1.9945 XP_004717125.1.18182 XP_004717126.1.18182 XP_004863464.1.39548 XP_004863465.1.39548 XP_005341171.1.77405 XP_005341172.1.77405 XP_005341173.1.77405 XP_005380221.2.28644 XP_006162052.1.99106 XP_006732808.1.47382 XP_006732809.1.47382 XP_006870238.1.41390 XP_006937114.1.62641 XP_006937115.1.62641 XP_007083219.1.5354 XP_007083220.1.5354 XP_008053844.1.4292 XP_008053845.1.4292 XP_008579793.1.73410 XP_008709190.1.72690 XP_013221040.1.77405 XP_014707600.1.49734 XP_014934761.1.86478 XP_014934762.1.86478 XP_014934763.1.86478 XP_015333060.1.40921 XP_015333061.1.40921 XP_015333062.1.40921 XP_019295678.1.44245 XP_019295679.1.44245 XP_019295680.1.44245 XP_019295681.1.44245 XP_019311688.1.44245 XP_019311689.1.44245 XP_019311690.1.44245 XP_019311691.1.44245 XP_021541387.1.83697 XP_534040.1.84170 ENSTBEP00000000203 ENSECAP00000005609 ENSCAFP00000033861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]