SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403844 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000403844
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.00000241
Family DNA polymerase processivity factor 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403844
Sequence length 280
Comment HUS1 (Homo_sapiens) HUS1 checkpoint homolog (S. pombe)
Sequence
MKFRAKIVDAACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDRLVGGGVSMWCELEQ
ENFFSEFQMEGVSAENNAIYLELTSENLSRALKTAQNARTLKIKLTNKHFPCLTVSVELL
SMSTSSRIVTHDIPLKVIPRKLWKDFQQPSVPDADVSIYLPVLKTLKSVVEKMKNISNHL
VIEANLNGELNLKIETDLVCVTTHFKDLGNPPLASDDASRDRDPAEMAEVHVDIRKLLQF
LAGQQVNPTRALCNLVSSRMVHLDLLHEDVCLQYFIPALS
Download sequence
Identical sequences G5B3U7
HGL_H00000403844 XP_004839932.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]