SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000403888 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000403888
Domain Number - Region: 288-434
Classification Level Classification E-value
Superfamily Tropomyosin 0.0307
Family Tropomyosin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000403888
Sequence length 703
Comment DISC1 (Homo_sapiens) disrupted in schizophrenia 1
Sequence
MQPAVKEQEAPRPQTLRYQQRRVAAAAGSRAAPSSSPVYGGPFTPPAPPGPHEAFASSFS
FIQLSLASVGERGEAEGCLPSREAESPHQSPRDMGPVASSSDRPHEDPGCLSGSFSPTAT
QGSADLAQEARSSFWPEWDMPSSLNLDTGSSSALGPMLTGCHGDKGSGSGNAHGWDDLLR
RWEPVLHDCLQSSSRQLEVTSLKLKLQKLQEKAIEDDDYDKAEMLRQRLEDLEQEPGHLS
MMLPSLQPALSSFLGHLVAQAQAVLHRATQLASSDSAPAPLGSESEPTAQDSLCEALARR
DWLLQEKRQLQKEVEALQERMSALEAKDQQLRREIEEQERELQWQGCGLVTLLVQLSREH
LQEVHEALRDTLASASQIPFHLEQPETIRSLRERIKVLNLSLQEISTKVCMGERLCSTLR
RRVSDLETQLLALLEAKMLAISGSHFCTAKDLTEEIRTLTSEREGLEPILSRLWALRSRT
AGELGSVVEDHSRLTKELQLQEAAHKASVKGSTVKYMEMLEDKMLSCKCPLLGRVWEADL
EACRLLVQSLELQEAGGNLSVEDEQQVDDTGAAAWTATLAGLPRHSSEDGRKSPLQVSHG
WRAPLTICVPCTGGEWKQESYVLSAELGEKCEAIDKKLLHLEDQLHTAIHSHDEDLIHSL
KGQLQMVKETLQAMLLQLQPAKEAGGGEAGAPSTAAASWEVQP
Download sequence
Identical sequences G5BQJ7
HGL_H00000403888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]