SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000404545-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000404545-2
Domain Number 1 Region: 420-503
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.84e-21
Family Canonical RBD 0.0045
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily SAP domain 0.0000000123
Family SAP domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000404545-2
Sequence length 946
Comment SAFB (Homo_sapiens) scaffold attachment factor B
Sequence
MAETLSGLGDSGAASAAALSSASSETGTRRLSDLRVIDLRAELRKRNLDSSGNKSVLMER
LKKAIEDEGGNPDEIEVTSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSL
ENLQDIDMMDISVLDEAEIDNGSVADCVEEEDADNLPESLSDSRELVEGEMKDLPEQLQE
HAVDDKETINNLDTSSSDFTILQEIEEPSLEPENEKILDILGETCKSEPVKEEGSELEQP
FAQDTSSVGPDRKLAEEEDLFGSAHPEEEEEEEQEEEEEEEEEEGDLDLASESTRAQWSE
ADTLLAVVKREPVEQTGEGARTDCEPVGLEKPVEQSSAASELPEASSQELAEAPTEAPSP
EPRDSKEDVKKFEFDACNEVPPAPKESSTSEGADQKMSSVEDDSDSKRLSREEKGHSSCS
RNFWVSGLSSMTRATDLKTLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCIN
HLHKTELHGKMISVEKAKNEPASKKTSEKRDSEGKKEKSSTSDRYFFPGERPLSANLKRD
DKSDRKDDSKKGEDASGEKSKDPDEKLGSSERSRATKSGSRGTERIVVMDKSKGVPVISV
KTSGSKERASKSQDRKSASREKRSVVSFDKVKEPRKSRDSESRSPVEKWTGHGRGATGRG
SDTDLSASVAWERPLRLEGQSCVETCRFLSEHCFLERCRRVKTASPGLNRAGRGILKTNE
MREQGGGQVHQPPRGRLGGNTCPVPSRRDDAYWPEAKRAALDERYHSDFSRQDRFHDFDH
RDRGRYPNHSVDRREGSRSMMGEREGQHYPERHGGPERHSRDSRDSWGYGSDKRMSEGRG
LPPPPRDRRDWGEHGRRLEDDRAWQGAADGGMIDRDHKRWQGGERSMSGHSGPGHMMNRG
GMSGRGSFAPGGASRGHVIPRGGMQGGFRGQSRGSRPSDTRFTRRY
Download sequence
Identical sequences G5C0Q8
HGL_H00000404545-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]