SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000404748 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000404748
Domain Number 1 Region: 8-353
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-108
Family ALDH-like 0.0000000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000404748
Sequence length 385
Comment ALDH3B2 (Homo_sapiens) aldehyde dehydrogenase 3 family, member B2
Sequence
MKDEPASTNLLTKMDCAFIRKEPFGLVLIIGPWNYPVNLTLVPLVGAIAAGNCVILKPSE
KSKGTEKVLAEVLPQYLNQSCFAVVVGGPEETQKLLEHKFDYIFFTGNPRVGKIVMAAAA
KHLTPVTLELGGKNPCYVDDNCDPQTVANRLAWFRYFNMGQTCVAPDYVLCSPDMQERLL
PALQNAITRFYGDDPQNSPNLGRIINQKHFKRLQELLSCGRVAIGGQSDESNLYIAPTVL
VDVQETDKVMQEEVFGPILPLMTVRSLDEAIDFINRREKPLALYAFSNNSQVVSQVLDRT
SSGNFGGNDGFLYMTLLSLPFGGVGKSGTGRYHGKFSFNTFSNHRACLISPSGLEKLNEI
RYPPYSSQAQKLLRWAMSSHSCTLL
Download sequence
Identical sequences G5BTW0
XP_012930200.1.39548 HGL_H00000404748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]