SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405112-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000405112-2
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-37
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 385-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405112-2
Sequence length 925
Comment ANKRD26 (Homo_sapiens) ankyrin repeat domain 26
Sequence
RTALHFACTSGHPEVVTLLVDRKCEINACDSENSTPLIKAVQCHQEECVTILLEHGADPN
IADVSSNTALHYAVSSENTSIAAKLLSHHADTEAKNKDDLTPYLLALKDNKQQVAELLIK
EKANIHAVDKPRRYSCLFFFLNKTFVVFYKQEQQGTRKAGADGAGPSGAQRQGECLEASR
EEALRIKSRGKRGPWGGDDLEWKSKNCQVKGPKTKTRPGHSKPLLGEWICWAVSEQKRGK
SNMASHEDLLPKNHRLQVEIARLRLERDAIKNQNQVKEKKYLEDTEIEHEKNDDLQKTIK
LTEERIFQCNGQLNSLTENTLLNSKLEKEKQIKERPETETESHRSSLGAAVHNYESQTSN
RDVELASQRGRNEQVRLQDKLNFAISNLKNNYEMLSQQLSQAERKFSSLGIELRLIRDAL
RENTSVLQQIQRDVKQTQCPMKEIKHMNQDEEGKVNKYMGTQESIEERLSQLESENALLR
HQLDDTHKKLDYKERTLINIQNQFHGTVKTLLGESKKQTLKLEDRNKEVMDECNHLKENT
YQYEKEKAEKEVVVRQLQQELADALKKQSMPEASLEVSSLYHINLEDETRDLKKKLSHIR
SLVCDKEQLKKFTALTEYQKYTLDEEKRKNGELRKELTGFKKLYKMTEIKLNEQENGDFR
FHGDLKSNELDIPINMLIHKVDDLAAKLETASFKCLHLDKSDFLQQELLSMKNILQKKCE
TLEKNEKKLEEEVVNLRNHVEENGVKHGQAEQYKQETEERVSQELVEKLKEVNLFSQIQA
ASQEIFQQLRETNNASMRSQTELIIEGLQAEVSKMKPQGKFNKIELEKYSQCYLELKSSE
SLSSEPNKANRRLQEANNKILVEQQQNPFLLSSVNTKPLLEYPCVGNLHHSLVFPRSFLP
RENFAVPPLNPKPSISSMESYLAEV
Download sequence
Identical sequences G5B8C3
HGL_H00000405112-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]