SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405289 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000405289
Domain Number 1 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 217-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 162-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 274-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 1-44
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-18
Family KRAB domain (Kruppel-associated box) 0.00072
Further Details:      
 
Domain Number 8 Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405289
Sequence length 513
Comment ZNF778 (Homo_sapiens) zinc finger protein 778
Sequence
SVTFEDVALDFTQEEWVLLDQSHRDLYREVMLENYENLTSRGKNPVVSFGLLGRRWRLCT
SCVTAWVMWTLCPLGNERDIASVPGWYEHSYFKTHMKTQNIWNAGNFTHSEGHAVPVQMH
TIKHYACKTCGKAFGRSSNLNRHMRTHTGEKPYECKECRKPFTTYSRLVEHFRTHTGEKP
YKCKDCGKAFTKRSGLITHVPTHASEKPYECKQCGKAFASSPRLSQHVRTHSGERPYTCK
ECGRAFLTSSYLRNHVRRTHSGERPYICGECGKAFHSSSYLRRHVKTHSGERPFTCKECG
RAFLTSSYLHNHVRKTHSGEVPYICGECGKVFHASSYLRRHVRTHSGERPYICKECGKAF
LNVSYLRKHLTIHTGEKPYECQECGKAYNRCNLLNEHLKTHTVEKPFDCHVCGKSFQYFS
YLTKHVRIHTGIKPYKCKYCGKAFTTSSSRTEHVRSHTGERPYECRECGKTFTSSSNLIH
HVKIHTREKPYKCEECGEAYSSICLLSDHLVTH
Download sequence
Identical sequences G5B353
HGL_H00000405289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]