SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000405453 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000405453
Domain Number 1 Region: 349-450
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000405453
Domain Number - Region: 174-249
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00199
Family Seryl-tRNA synthetase (SerRS) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000405453
Sequence length 451
Comment MSR1 (Homo_sapiens) macrophage scavenger receptor 1
Sequence
MERQNIFLDHQEDPDSYSDCVKFDARSMTALLPPYPKNGLQEKLKSFKAALIALYLLVFV
VLIPVIGIVAAHLLKWEMKNCTVGSIHASDMSQSLGRQNVSGDEMRFREIILEHIDNIEK
RIQHISDLEANFIDSDYFQNFSATTDQRFNDTLLQLSTLVSSVQEHGNAVDEISKSLISL
NITLLDLQLNIETMSSKIQETTLKQKEDISKLKESVYNTSTEIKSLKEEQEHLEQEIKRE
VKALNNITNDLRLKDWEHSLTLRNITLIQGPPGPRGEKGDRGPAGEIGLPGIPGPIGPPG
LKGDRGVVGFPGSRGIPGLIGKAGRTGNPGQKGQKGERGSGNTFTLTKTVRLADGSGPHE
GRVEVFHEGQWGTICDDRWEIRGASVVCRSLGYKGVRNVHKAAYFGQGTGPIWLNEVYCF
GRESSIEECNIKQWGVRVCTHSEDAGVTCTI
Download sequence
Identical sequences G5BG50
HGL_H00000405453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]